PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco026269.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family YABBY
Protein Properties Length: 50aa    MW: 5383.98 Da    PI: 7.5231
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco026269.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY55.52.4e-17132135166
        YABBY 135 eeiqrikasnPdishreafsaaaknWahfPki 166
                  eeiqrik+++P i+h+ afs+aaknWahfP+i
  Aco026269.1   1 EEIQRIKTKDPTITHKAAFSTAAKNWAHFPRI 32 
                  8*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046905.0E-16133IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 50 aa     Download sequence    Send to blast
EEIQRIKTKD PTITHKAAFS TAAKNWAHFP RIPAKGDGES CSVSGEEKD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940212.13e-18PREDICTED: protein YABBY 7-like
SwissprotA2PZN88e-13YAB7_ORYSJ; Protein YABBY 7
TrEMBLF1AM021e-16F1AM02_ANNCH; Transcription factor INO
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.26e-13YABBY family protein